General Information

  • ID:  hor002731
  • Uniprot ID:  F5XVF0
  • Protein name:  Ci-NTLP-6
  • Gene name:  NA
  • Organism:  Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AVLHLAINEFQRL
  • Length:  13(145-157)
  • Propeptide:  MTSQRSTTRTSVVVSVLVLLFWCQVFYTSKADGATVELNRAAKVRSKRHVADMLITEKVSRVKRGHNKNLLLSRILQLTDASTGGHCQCILQQKAVKQGCECNEPILYLRMIRKITDPKMKLGHGSNAAELDRLLARMKPNMKRAVLHLAINEFQRLLREVEVERTRRGRIIRNLIRRRRKLRHHPRSAFDGKQLFSF
  • Signal peptide:  MTSQRSTTRTSVVVSVLVLLFWCQVFYTSKADG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  The sequence shown here is derived from an EMBL/GenBank/DDBJ third party annotation (TPA) entry.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F5XVF0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002731_AF2.pdbhor002731_ESM.pdb

Physical Information

Mass: 173804 Formula: C70H114N20O18
Absent amino acids: CDGKMPSTWY Common amino acids: L
pI: 7.55 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 8
Hydrophobicity: 63.85 Boman Index: -825
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 157.69
Instability Index: 923.08 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21467196
  • Title:  Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides